eF-site ID 4agk-A PDB Code 4agk Chain A click to enlarge Title Crystal structure of capsid protein (110-267) from Aura virus Classification HYDROLASE Compound CAPSID PROTEIN Source Aura virus (AURAV) (POLS_AURAV) Sequence A:  DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALA KLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWH HGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLG GANEGARTALSVVTWNKKGAAIKTTHEDTVEW Description Functional site 1) chain A residue 191 type SITE sequence F description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 2) chain A residue 192 type SITE sequence Y description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 225 type SITE sequence N description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 267 type SITE sequence W description Cleavage; by autolysis => ECO:0000250|UniProtKB:P03315 source Swiss-Prot : SWS_FT_FI3 5) chain A residue 144 type ACT_SITE sequence H description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 166 type ACT_SITE sequence D description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 218 type ACT_SITE sequence S description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links