eF-site ID 4agj-A PDB Code 4agj Chain A click to enlarge Title Crystal structure of the capsid protein (110-267) from Aura virus in complex with dioxane Classification HYDROLASE Compound CAPSID PROTEIN Source null (POLS_AURAV) Sequence A:  DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALA KLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWH HGAVQFSGGRFTIPTGAGGPGDSGRPILDDSGKVVAIVLG GANEGARTALSVVTWNKKGAAIKTTHEDTVEW Description Functional site 1) chain A residue 135 type sequence M description BINDING SITE FOR RESIDUE DIO A 1159 source : AC1 2) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE DIO A 1159 source : AC1 3) chain A residue 138 type sequence K description BINDING SITE FOR RESIDUE DIO A 1159 source : AC1 4) chain A residue 183 type sequence Y description BINDING SITE FOR RESIDUE DIO A 1159 source : AC1 5) chain A residue 250 type sequence W description BINDING SITE FOR RESIDUE DIO A 1159 source : AC1 6) chain A residue 144 type ACT_SITE sequence H description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 166 type ACT_SITE sequence D description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 218 type ACT_SITE sequence S description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01027 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 225 type SITE sequence D description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 191 type SITE sequence F description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 192 type SITE sequence Y description Involved in dimerization of the capsid protein => ECO:0000269|PubMed:25100849 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 267 type SITE sequence W description Cleavage; by autolysis => ECO:0000250|UniProtKB:P03315 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links