eF-site ID 4aa6-F PDB Code 4aa6 Chain F click to enlarge Title The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation Classification TRANSCRIPTION/DNA Compound ESTROGEN RECEPTOR Source (4AA6) Sequence F:  TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMC PATNQCTIDKRKSCQACRLRKCYEVGMMK Description (1)  ESTROGEN RECEPTOR Functional site 1) chain F residue 185 type sequence C description BINDING SITE FOR RESIDUE ZN F 253 source : AC7 2) chain F residue 188 type sequence C description BINDING SITE FOR RESIDUE ZN F 253 source : AC7 3) chain F residue 202 type sequence C description BINDING SITE FOR RESIDUE ZN F 253 source : AC7 4) chain F residue 205 type sequence C description BINDING SITE FOR RESIDUE ZN F 253 source : AC7 5) chain F residue 221 type sequence C description BINDING SITE FOR RESIDUE ZN F 254 source : AC8 6) chain F residue 227 type sequence C description BINDING SITE FOR RESIDUE ZN F 254 source : AC8 7) chain F residue 237 type sequence C description BINDING SITE FOR RESIDUE ZN F 254 source : AC8 8) chain F residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN F 254 source : AC8 9) chain F residue 185-250 type DNA_BIND sequence CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPAT NQCTIDKRKSCQACRLRKCYEVGM description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 10) chain F residue 185-205 type ZN_FING sequence CAVCNDYASGYHYGVWSCEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 11) chain F residue 221-245 type ZN_FING sequence CPATNQCTIDKRKSCQACRLRKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links