eF-site ID 4aa6-E PDB Code 4aa6 Chain E click to enlarge Title The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation Classification TRANSCRIPTION/DNA Compound ESTROGEN RECEPTOR Source (4AA6) Sequence E:  RYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPAT NQCTIDKNRRKSCQACRLRKCYEVGMMK Description (1)  ESTROGEN RECEPTOR Functional site 1) chain E residue 185 type sequence C description BINDING SITE FOR RESIDUE ZN E 253 source : AC5 2) chain E residue 188 type sequence C description BINDING SITE FOR RESIDUE ZN E 253 source : AC5 3) chain E residue 202 type sequence C description BINDING SITE FOR RESIDUE ZN E 253 source : AC5 4) chain E residue 205 type sequence C description BINDING SITE FOR RESIDUE ZN E 253 source : AC5 5) chain E residue 221 type sequence C description BINDING SITE FOR RESIDUE ZN E 254 source : AC6 6) chain E residue 227 type sequence C description BINDING SITE FOR RESIDUE ZN E 254 source : AC6 7) chain E residue 237 type sequence C description BINDING SITE FOR RESIDUE ZN E 254 source : AC6 8) chain E residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN E 254 source : AC6 9) chain E residue 185-250 type DNA_BIND sequence CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPATNQ CTIDKNRRKSCQACRLRKCYEVGM description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 10) chain E residue 185-205 type ZN_FING sequence CAVCNDYASGYHYGVWSCEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 11) chain E residue 221-245 type ZN_FING sequence CPATNQCTIDKNRRKSCQACRLRKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links