eF-site ID 4aa6-A PDB Code 4aa6 Chain A click to enlarge Title The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation Classification TRANSCRIPTION/DNA Compound ESTROGEN RECEPTOR Source (4AA6) Sequence A:  TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIHNDYMCPA TNQCTIDKNRRKSCQACRLRKCYEVGMMK Description (1)  ESTROGEN RECEPTOR Functional site 1) chain A residue 185 type sequence C description BINDING SITE FOR RESIDUE ZN A 253 source : AC1 2) chain A residue 188 type sequence C description BINDING SITE FOR RESIDUE ZN A 253 source : AC1 3) chain A residue 202 type sequence C description BINDING SITE FOR RESIDUE ZN A 253 source : AC1 4) chain A residue 205 type sequence C description BINDING SITE FOR RESIDUE ZN A 253 source : AC1 5) chain A residue 221 type sequence C description BINDING SITE FOR RESIDUE ZN A 254 source : AC2 6) chain A residue 227 type sequence C description BINDING SITE FOR RESIDUE ZN A 254 source : AC2 7) chain A residue 237 type sequence C description BINDING SITE FOR RESIDUE ZN A 254 source : AC2 8) chain A residue 240 type sequence C description BINDING SITE FOR RESIDUE ZN A 254 source : AC2 9) chain A residue 185-211 type prosite sequence CAVCNDYASGYHYGVWSCEGCKAFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CavCn.Dyasgy.HYgvwsCegCkaFFkR source prosite : PS00031 10) chain A residue 185-250 type DNA_BIND sequence CAVCNDYASGYHYGVWSCEGCKAFFKRSIHNDYMCPATNQ CTIDKNRRKSCQACRLRKCYEVGM description Nuclear receptor => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 185-205 type ZN_FING sequence CAVCNDYASGYHYGVWSCEGC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 221-245 type ZN_FING sequence CPATNQCTIDKNRRKSCQACRLRKC description NR C4-type => ECO:0000255|PROSITE-ProRule:PRU00407 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links