eF-site ID 4a4e_14-A PDB Code 4a4e Model 14 Chain A click to enlarge Title Solution structure of SMN Tudor domain in complex with symmetrically dimethylated arginine Classification RNA BINDING PROTEIN Compound SURVIVAL MOTOR NEURON PROTEIN Source null (SMN_HUMAN) Sequence A:  NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETC VVVYTGYGNREEQNLSDLLSPICE Description Functional site 1) chain A residue 102 type sequence W description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 2) chain A residue 105 type sequence D description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 3) chain A residue 109 type sequence Y description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 4) chain A residue 127 type sequence Y description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 5) chain A residue 130 type sequence Y description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 6) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE 2MR A 1148 source : AC1 7) chain A residue 85 type MOD_RES sequence T description Phosphothreonine; by PKA => ECO:0000269|PubMed:21609790 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links