eF-site ID 4a49-AB PDB Code 4a49 Chain A, B click to enlarge Title Structure of phosphoTyr371-c-Cbl-UbcH5B complex Classification LIGASE Compound E3 ubiquitin-protein ligase CBL Source (UB2D2_HUMAN) Sequence A:  DHIKVTQEQFELXCEMGSTFQLCKICAENDKDVKIEPCGH LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD B:  ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPN DSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSN GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVP EIARIYKTDREKYNRIAREWTQKYAM Description Functional site 1) chain A residue 381 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 2) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 3) chain A residue 401 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 4) chain A residue 404 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 5) chain A residue 396 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 6) chain A residue 398 type sequence H description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 7) chain A residue 416 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 8) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 9) chain B residue 7 type sequence H description BINDING SITE FOR RESIDUE K B 1148 source : AC3 10) chain B residue 7 type sequence H description BINDING SITE FOR RESIDUE K B 1148 source : AC3 11) chain A residue 396-405 type prosite sequence CGHLMCTSCL description ZF_RING_1 Zinc finger RING-type signature. CgHlMCtsCL source prosite : PS00518 12) chain B residue 74-89 type prosite sequence YHPNINSNGSICLDIL description UBC_1 Ubiquitin-conjugating (UBC) active site signature. YHPNInsn.GsICLdiL source prosite : PS00183 13) chain B residue 85 type ACT_SITE sequence C description Glycyl thioester intermediate => ECO:0000255|PROSITE-ProRule:PRU00388, ECO:0000255|PROSITE-ProRule:PRU10133 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 371 type MOD_RES sequence X description Phosphotyrosine; by INSR => ECO:0000269|PubMed:11997497 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links