eF-site ID 4a49-A PDB Code 4a49 Chain A click to enlarge Title Structure of phosphoTyr371-c-Cbl-UbcH5B complex Classification LIGASE Compound E3 ubiquitin-protein ligase CBL Source (UB2D2_HUMAN) Sequence A:  DHIKVTQEQFELXCEMGSTFQLCKICAENDKDVKIEPCGH LMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFD Description Functional site 1) chain A residue 381 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 2) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 3) chain A residue 401 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 4) chain A residue 404 type sequence C description BINDING SITE FOR RESIDUE ZN A 1436 source : AC1 5) chain A residue 396 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 6) chain A residue 398 type sequence H description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 7) chain A residue 416 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 8) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1437 source : AC2 9) chain A residue 396-405 type prosite sequence CGHLMCTSCL description ZF_RING_1 Zinc finger RING-type signature. CgHlMCtsCL source prosite : PS00518 10) chain A residue 371 type MOD_RES sequence X description Phosphotyrosine; by INSR => ECO:0000269|PubMed:11997497 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links