eF-site ID 3zoo-D PDB Code 3zoo Chain D click to enlarge Title Structure of the Y46F mutant of human cytochrome c Classification OXIDOREDUCTASE Compound CYTOCHROME C Source Homo sapiens (Human) (CYC_HUMAN) Sequence D:  GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKM IFVGIKKKEERADLIAYLKKATNE Description Functional site 1) chain D residue 55 type sequence K description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 2) chain D residue 13 type sequence K description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 3) chain D residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 4) chain D residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 5) chain D residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 6) chain D residue 28 type sequence T description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 7) chain D residue 30 type sequence P description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 8) chain D residue 40 type sequence T description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 9) chain D residue 41 type sequence G description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 10) chain D residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 11) chain D residue 49 type sequence T description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 12) chain D residue 52 type sequence N description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 13) chain D residue 59 type sequence W description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 14) chain D residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 15) chain D residue 78 type sequence T description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 16) chain D residue 79 type sequence K description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 17) chain D residue 80 type sequence M description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 18) chain D residue 81 type sequence I description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 19) chain D residue 82 type sequence F description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 20) chain D residue 85 type sequence I description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 21) chain D residue 79 type sequence K description BINDING SITE FOR RESIDUE PO4 A 1105 source : AC5 22) chain D residue 14 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 23) chain D residue 17 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 24) chain D residue 18 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI2 25) chain D residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI3 26) chain D residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:13933734 source Swiss-Prot : SWS_FT_FI4 27) chain D residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 28) chain D residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 29) chain D residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 30) chain D residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI7 31) chain D residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links