eF-site ID 3zoo-C PDB Code 3zoo Chain C click to enlarge Title Structure of the Y46F mutant of human cytochrome c Classification OXIDOREDUCTASE Compound CYTOCHROME C Source Homo sapiens (Human) (CYC_HUMAN) Sequence C:  GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKM IFVGIKKKEERADLIAYLKKATNE Description Functional site 1) chain C residue 13 type sequence K description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 2) chain C residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 3) chain C residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 4) chain C residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 5) chain C residue 28 type sequence T description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 6) chain C residue 30 type sequence P description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 7) chain C residue 40 type sequence T description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 8) chain C residue 41 type sequence G description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 9) chain C residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 10) chain C residue 49 type sequence T description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 11) chain C residue 52 type sequence N description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 12) chain C residue 59 type sequence W description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 13) chain C residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 14) chain C residue 68 type sequence L description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 15) chain C residue 78 type sequence T description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 16) chain C residue 79 type sequence K description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 17) chain C residue 80 type sequence M description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 18) chain C residue 82 type sequence F description BINDING SITE FOR RESIDUE HEC C 105 source : AC3 19) chain C residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 20) chain C residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:13933734 source Swiss-Prot : SWS_FT_FI4 21) chain C residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 22) chain C residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 23) chain C residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 24) chain C residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI7 25) chain C residue 14 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 26) chain C residue 17 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 27) chain C residue 18 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI2 28) chain C residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI3

Display surface Download Links