eF-site ID 3zk2-S PDB Code 3zk2 Chain S click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence S:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain S residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU R 92 source : EC1 2) chain S residue 32 type sequence E description BINDING SITE FOR RESIDUE NA S 90 source : EC2 3) chain S residue 65 type sequence E description BINDING SITE FOR RESIDUE NA S 90 source : EC2 4) chain S residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU S 92 source : EC3 5) chain S residue 63 type sequence V description BINDING SITE FOR RESIDUE NA T 90 source : EC4 6) chain S residue 66 type sequence S description BINDING SITE FOR RESIDUE NA T 90 source : EC4 7) chain S residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 8) chain S residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 9) chain S residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links