eF-site ID 3zk2-O PDB Code 3zk2 Chain O click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence O:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain O residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 2) chain O residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 3) chain O residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 4) chain O residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 5) chain O residue 32 type sequence E description BINDING SITE FOR RESIDUE NA O 90 source : DC3 6) chain O residue 65 type sequence E description BINDING SITE FOR RESIDUE NA O 90 source : DC3 7) chain O residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU O 92 source : DC4 8) chain O residue 63 type sequence V description BINDING SITE FOR RESIDUE NA P 90 source : DC5 9) chain O residue 66 type sequence S description BINDING SITE FOR RESIDUE NA P 90 source : DC5 10) chain O residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain O residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain O residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links