eF-site ID 3zk2-M PDB Code 3zk2 Chain M click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence M:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain M residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU L 92 source : CC7 2) chain M residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU L 92 source : CC7 3) chain M residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU L 92 source : CC7 4) chain M residue 32 type sequence E description BINDING SITE FOR RESIDUE NA M 90 source : CC8 5) chain M residue 65 type sequence E description BINDING SITE FOR RESIDUE NA M 90 source : CC8 6) chain M residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU M 92 source : CC9 7) chain M residue 63 type sequence V description BINDING SITE FOR RESIDUE NA N 90 source : DC1 8) chain M residue 66 type sequence S description BINDING SITE FOR RESIDUE NA N 90 source : DC1 9) chain M residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 10) chain M residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain M residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links