eF-site ID 3zk2-L PDB Code 3zk2 Chain L click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence L:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain L residue 32 type sequence E description BINDING SITE FOR RESIDUE NA L 90 source : CC6 2) chain L residue 65 type sequence E description BINDING SITE FOR RESIDUE NA L 90 source : CC6 3) chain L residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU L 92 source : CC7 4) chain L residue 63 type sequence V description BINDING SITE FOR RESIDUE NA M 90 source : CC8 5) chain L residue 66 type sequence S description BINDING SITE FOR RESIDUE NA M 90 source : CC8 6) chain L residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU V 92 source : EC9 7) chain L residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU V 92 source : EC9 8) chain L residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU V 92 source : EC9 9) chain L residue 16 type sequence V description BINDING SITE FOR RESIDUE DMU V 92 source : EC9 10) chain L residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain L residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain L residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links