eF-site ID 3zk2-K PDB Code 3zk2 Chain K click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence K:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain K residue 63 type sequence V description BINDING SITE FOR RESIDUE NA A 90 source : AC1 2) chain K residue 66 type sequence S description BINDING SITE FOR RESIDUE NA A 90 source : AC1 3) chain K residue 87 type sequence K description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 4) chain K residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU J 92 source : CC3 5) chain K residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU J 92 source : CC3 6) chain K residue 32 type sequence E description BINDING SITE FOR RESIDUE NA K 90 source : CC4 7) chain K residue 65 type sequence E description BINDING SITE FOR RESIDUE NA K 90 source : CC4 8) chain K residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU K 92 source : CC5 9) chain K residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU K 92 source : CC5 10) chain K residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain K residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain K residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links