eF-site ID 3zk2-I PDB Code 3zk2 Chain I click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence I:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain I residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU H 92 source : BC8 2) chain I residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU H 92 source : BC8 3) chain I residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU H 92 source : BC8 4) chain I residue 32 type sequence E description BINDING SITE FOR RESIDUE NA I 90 source : BC9 5) chain I residue 65 type sequence E description BINDING SITE FOR RESIDUE NA I 90 source : BC9 6) chain I residue 63 type sequence V description BINDING SITE FOR RESIDUE NA J 90 source : CC2 7) chain I residue 66 type sequence S description BINDING SITE FOR RESIDUE NA J 90 source : CC2 8) chain I residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 9) chain I residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 10) chain I residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links