eF-site ID 3zk2-D PDB Code 3zk2 Chain D click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence D:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain D residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU C 92 source : AC7 2) chain D residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU C 92 source : AC7 3) chain D residue 32 type sequence E description BINDING SITE FOR RESIDUE NA D 90 source : AC8 4) chain D residue 65 type sequence E description BINDING SITE FOR RESIDUE NA D 90 source : AC8 5) chain D residue 63 type sequence V description BINDING SITE FOR RESIDUE NA E 90 source : BC1 6) chain D residue 66 type sequence S description BINDING SITE FOR RESIDUE NA E 90 source : BC1 7) chain D residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 8) chain D residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 9) chain D residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links