eF-site ID 3zk2-C PDB Code 3zk2 Chain C click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence C:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain C residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU B 92 source : AC5 2) chain C residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU B 92 source : AC5 3) chain C residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU B 92 source : AC5 4) chain C residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU B 92 source : AC5 5) chain C residue 32 type sequence E description BINDING SITE FOR RESIDUE NA C 90 source : AC6 6) chain C residue 65 type sequence E description BINDING SITE FOR RESIDUE NA C 90 source : AC6 7) chain C residue 63 type sequence V description BINDING SITE FOR RESIDUE NA D 90 source : AC8 8) chain C residue 66 type sequence S description BINDING SITE FOR RESIDUE NA D 90 source : AC8 9) chain C residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 10) chain C residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain C residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links