eF-site ID 3zk2-A PDB Code 3zk2 Chain A click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 8.7 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source (ATPL_FUSNN) Sequence A:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain A residue 32 type sequence E description BINDING SITE FOR RESIDUE NA A 90 source : AC1 2) chain A residue 65 type sequence E description BINDING SITE FOR RESIDUE NA A 90 source : AC1 3) chain A residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 4) chain A residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 5) chain A residue 7 type sequence K description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 6) chain A residue 80 type sequence Y description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 7) chain A residue 81 type sequence A description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 8) chain A residue 85 type sequence L description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 9) chain A residue 86 type sequence S description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 10) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE DMU A 93 source : AC3 11) chain A residue 63 type sequence V description BINDING SITE FOR RESIDUE NA B 90 source : AC4 12) chain A residue 66 type sequence S description BINDING SITE FOR RESIDUE NA B 90 source : AC4 13) chain A residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU K 92 source : CC5 14) chain A residue 44-65 type prosite sequence ARQPEARGSIISTMILGQAVAE description ATPASE_C ATP synthase c subunit signature. ARQPeargsIiStmILgqaVaE source prosite : PS00605 15) chain A residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links