eF-site ID 3zk1-U PDB Code 3zk1 Chain U click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source null (ATPL_FUSNN) Sequence U:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain U residue 32 type sequence E description BINDING SITE FOR RESIDUE NA U 90 source : EC7 2) chain U residue 65 type sequence E description BINDING SITE FOR RESIDUE NA U 90 source : EC7 3) chain U residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU U 92 source : EC8 4) chain U residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU U 92 source : EC8 5) chain U residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU U 92 source : EC8 6) chain U residue 16 type sequence V description BINDING SITE FOR RESIDUE DMU U 92 source : EC8 7) chain U residue 63 type sequence V description BINDING SITE FOR RESIDUE NA V 90 source : EC9 8) chain U residue 66 type sequence S description BINDING SITE FOR RESIDUE NA V 90 source : EC9 9) chain U residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU V 92 source : FC1 10) chain U residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain U residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain U residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links