eF-site ID 3zk1-S PDB Code 3zk1 Chain S click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) (ATPL_FUSNN) Sequence S:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain S residue 32 type sequence E description BINDING SITE FOR RESIDUE NA S 90 source : EC3 2) chain S residue 65 type sequence E description BINDING SITE FOR RESIDUE NA S 90 source : EC3 3) chain S residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU S 92 source : EC4 4) chain S residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU S 92 source : EC4 5) chain S residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU S 92 source : EC4 6) chain S residue 63 type sequence V description BINDING SITE FOR RESIDUE NA T 90 source : EC5 7) chain S residue 66 type sequence S description BINDING SITE FOR RESIDUE NA T 90 source : EC5 8) chain S residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU T 92 source : EC6 9) chain S residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU T 92 source : EC6 10) chain S residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain S residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain S residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links