eF-site ID 3zk1-N PDB Code 3zk1 Chain N click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) (ATPL_FUSNN) Sequence N:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain N residue 80 type sequence Y description BINDING SITE FOR RESIDUE TAM M 1090 source : CC9 2) chain N residue 32 type sequence E description BINDING SITE FOR RESIDUE NA N 90 source : DC1 3) chain N residue 65 type sequence E description BINDING SITE FOR RESIDUE NA N 90 source : DC1 4) chain N residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 5) chain N residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 6) chain N residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 7) chain N residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU N 92 source : DC2 8) chain N residue 63 type sequence V description BINDING SITE FOR RESIDUE NA O 90 source : DC3 9) chain N residue 66 type sequence S description BINDING SITE FOR RESIDUE NA O 90 source : DC3 10) chain N residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU O 92 source : DC4 11) chain N residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU O 92 source : DC4 12) chain N residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 13) chain N residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 14) chain N residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links