eF-site ID 3zk1-K PDB Code 3zk1 Chain K click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) (ATPL_FUSNN) Sequence K:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain K residue 63 type sequence V description BINDING SITE FOR RESIDUE NA A 90 source : AC1 2) chain K residue 66 type sequence S description BINDING SITE FOR RESIDUE NA A 90 source : AC1 3) chain K residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 4) chain K residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 5) chain K residue 32 type sequence E description BINDING SITE FOR RESIDUE NA K 90 source : CC3 6) chain K residue 65 type sequence E description BINDING SITE FOR RESIDUE NA K 90 source : CC3 7) chain K residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU K 92 source : CC4 8) chain K residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU K 92 source : CC4 9) chain K residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 10) chain K residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain K residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links