eF-site ID 3zk1-E PDB Code 3zk1 Chain E click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source null (ATPL_FUSNN) Sequence E:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain E residue 32 type sequence E description BINDING SITE FOR RESIDUE NA E 90 source : AC9 2) chain E residue 65 type sequence E description BINDING SITE FOR RESIDUE NA E 90 source : AC9 3) chain E residue 2 type sequence D description BINDING SITE FOR RESIDUE DMU E 92 source : BC1 4) chain E residue 5 type sequence T description BINDING SITE FOR RESIDUE DMU E 92 source : BC1 5) chain E residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU E 92 source : BC1 6) chain E residue 63 type sequence V description BINDING SITE FOR RESIDUE NA F 90 source : BC2 7) chain E residue 66 type sequence S description BINDING SITE FOR RESIDUE NA F 90 source : BC2 8) chain E residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU F 92 source : BC3 9) chain E residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU F 92 source : BC3 10) chain E residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain E residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain E residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links