eF-site ID 3zk1-A PDB Code 3zk1 Chain A click to enlarge Title Crystal structure of the sodium binding rotor ring at pH 5.3 Classification MEMBRANE PROTEIN Compound ATP SYNTHASE SUBUNIT C Source Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) (ATPL_FUSNN) Sequence A:  MDLLTAKTIVLGCSAVGAGLAMIAGLGPGIGEGYAAGKAV ESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY ANPFLSKLG Description Functional site 1) chain A residue 32 type sequence E description BINDING SITE FOR RESIDUE NA A 90 source : AC1 2) chain A residue 65 type sequence E description BINDING SITE FOR RESIDUE NA A 90 source : AC1 3) chain A residue 13 type sequence C description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 4) chain A residue 16 type sequence V description BINDING SITE FOR RESIDUE DMU A 92 source : AC2 5) chain A residue 63 type sequence V description BINDING SITE FOR RESIDUE NA B 90 source : AC3 6) chain A residue 66 type sequence S description BINDING SITE FOR RESIDUE NA B 90 source : AC3 7) chain A residue 1 type sequence M description BINDING SITE FOR RESIDUE DMU B 92 source : AC4 8) chain A residue 9 type sequence I description BINDING SITE FOR RESIDUE DMU B 92 source : AC4 9) chain A residue 70 type sequence Y description BINDING SITE FOR RESIDUE LMT B 1090 source : FC2 10) chain A residue 9-29 type TRANSMEM sequence IVLGCSAVGAGLAMIAGLGPG description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 58-78 type TRANSMEM sequence ILGQAVAESTGIYSLVIALIL description Helical => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 65 type SITE sequence E description Reversibly protonated during proton transport => ECO:0000255|HAMAP-Rule:MF_01396 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 44-65 type prosite sequence ARQPEARGSIISTMILGQAVAE description ATPASE_C ATP synthase c subunit signature. ARQPeargsIiStmILgqaVaE source prosite : PS00605

Display surface Download Links