eF-site ID 3zhw-A PDB Code 3zhw Chain A click to enlarge Title X-ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and their Functional Implications Classification OXYGEN BINDING Compound NON-SYMBIOTIC HEMOGLOBIN 1 Source Arabidopsis thaliana (Mouse-ear cress) (HBL1_ARATH) Sequence A:  KIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPT TKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLR KTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETI KEAVPEMWSPEMKVAWGQAYDHLVAAIKAEMNLS Description Functional site 1) chain A residue 65 type sequence K description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 2) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 3) chain A residue 72 type sequence S description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 4) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 5) chain A residue 100 type sequence L description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 6) chain A residue 103 type sequence S description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 7) chain A residue 104 type sequence H description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 8) chain A residue 107 type sequence Y description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 9) chain A residue 113 type sequence H description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 10) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 11) chain A residue 117 type sequence A description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 12) chain A residue 148 type sequence L description BINDING SITE FOR RESIDUE HEM A 1163 source : AC1 13) chain A residue 126 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1902 source : AC2 14) chain A residue 133 type sequence W description BINDING SITE FOR RESIDUE SO4 A 1902 source : AC2 15) chain A residue 138 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1902 source : AC2 16) chain A residue 118 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1904 source : AC3 17) chain A residue 139 type sequence V description BINDING SITE FOR RESIDUE SO4 A 1904 source : AC3 18) chain A residue 142 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1904 source : AC3 19) chain A residue 143 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 1904 source : AC3 20) chain A residue 146 type sequence D description BINDING SITE FOR RESIDUE SO4 A 1904 source : AC3 21) chain A residue 53 type sequence L description BINDING SITE FOR RESIDUE SO4 A 1905 source : AC4 22) chain A residue 54 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1905 source : AC4 23) chain A residue 65 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1905 source : AC4 24) chain A residue 69 type BINDING sequence H description distal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 104 type BINDING sequence H description proximal binding residue => ECO:0000255|PROSITE-ProRule:PRU00238 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 63-74 type prosite sequence NPKLKPHAMSVF description PLANT_GLOBIN Plant hemoglobins signature. NPkLkpHAmsvF source prosite : PS00208

Display surface Download Links