eF-site ID 3ze4-A
PDB Code 3ze4
Chain A

click to enlarge
Title Crystal structure of the integral membrane diacylglycerol kinase - wild-type
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence A:  FTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLAVVIAC
WLDVDAITRVLLISSVMLVMIVEILNSAIEAVVDRIGSEY
HELSGRAKDMGSAAVLIAIIVAVITWCILLWSHF
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)

Display surface

Download
Links