eF-site ID 3ze3-D
PDB Code 3ze3
Chain D

click to enlarge
Title Crystal structure of the integral membrane diacylglycerol kinase - delta7
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence D:  AGYSWKGLRAAWINEAAFRQEGVAVLLCVVIAAWLDVDAV
TRVLLISSVMLVMIVELLNSAIEAVVDRIGSEYHELSGRA
KDLGSAAVLIAIIDAVITWAILLWSHFG
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)


Functional site

1) chain D
residue 64
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

2) chain D
residue 107
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

3) chain D
residue 60
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NA E 1122
source : AC2

4) chain D
residue 28
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1122
source : AC3

5) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1122
source : AC3

6) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FLC D 1123
source : AC4

7) chain D
residue 28
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

8) chain D
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

9) chain D
residue 72
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

10) chain D
residue 73
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

11) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

12) chain D
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

13) chain D
residue 29
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

14) chain D
residue 32
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

15) chain D
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

16) chain D
residue 36
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

17) chain D
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

18) chain D
residue 22
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

19) chain D
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

20) chain D
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

21) chain D
residue 109
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

22) chain D
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

23) chain D
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

24) chain D
residue 48
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

25) chain D
residue 49
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

26) chain D
residue 120
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

27) chain D
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

28) chain D
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

29) chain D
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

30) chain D
residue 39
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

31) chain D
residue 40
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

32) chain D
residue 47-49
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WLD
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

33) chain D
residue 120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

34) chain D
residue 33-34
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence QE
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

35) chain D
residue 98
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence S
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

36) chain D
residue 101-102
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

37) chain D
residue 105-106
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence II
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

38) chain D
residue 109-110
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

39) chain D
residue 113-114
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

40) chain D
residue 33
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence Q
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

41) chain D
residue 36-37
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

42) chain D
residue 39-40
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

43) chain D
residue 43
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

44) chain D
residue 25
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

45) chain D
residue 29
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

46) chain D
residue 32-33
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence RQ
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

47) chain D
residue 36
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

48) chain D
residue 21-22
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LR
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

49) chain D
residue 25-26
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

50) chain D
residue 31
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

51) chain D
residue 35
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence G
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

52) chain D
residue 38-39
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

53) chain D
residue 63
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

54) chain D
residue 66
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

55) chain D
residue 27-28
type binding
ligand FLC: CITRATE ANION
sequence NE
description CITRATE ANION binding site
source pdb_hetatom : FLC_3ze3_D_1123

56) chain D
residue 76
type binding
ligand FLC: CITRATE ANION
sequence E
description CITRATE ANION binding site
source pdb_hetatom : FLC_3ze3_D_1123

57) chain D
residue 28
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

58) chain D
residue 30
type binding
ligand ACT: ACETATE ION
sequence A
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

59) chain D
residue 69
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

60) chain D
residue 72-73
type binding
ligand ACT: ACETATE ION
sequence NS
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

61) chain D
residue 76
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124


Display surface

Download
Links