eF-site ID 3ze3-B
PDB Code 3ze3
Chain B

click to enlarge
Title Crystal structure of the integral membrane diacylglycerol kinase - delta7
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence B:  AWINEAAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVM
LVMIVELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI
AIIDAVITWAILLWSHFG
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)


Functional site

1) chain B
residue 98
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

2) chain B
residue 101
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

3) chain B
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

4) chain B
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

5) chain B
residue 110
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

6) chain B
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

7) chain B
residue 65
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

8) chain B
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

9) chain B
residue 108
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

10) chain B
residue 112
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

11) chain B
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

12) chain B
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

13) chain B
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

14) chain B
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

15) chain B
residue 35
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

16) chain B
residue 36
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

17) chain B
residue 114
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

18) chain B
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

19) chain B
residue 34
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

20) chain B
residue 37-38
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

21) chain B
residue 41
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence C
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

22) chain B
residue 62
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

23) chain B
residue 65
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

24) chain B
residue 69
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

25) chain B
residue 101
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

26) chain B
residue 105
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

27) chain B
residue 108-109
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

28) chain B
residue 112-113
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

29) chain B
residue 116
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

30) chain B
residue 69
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

31) chain B
residue 72
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence N
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

32) chain B
residue 98-99
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence SA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

33) chain B
residue 101-102
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

34) chain B
residue 105-106
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence II
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

35) chain B
residue 109-110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

36) chain B
residue 103
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

37) chain B
residue 106
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

38) chain B
residue 110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

39) chain B
residue 110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

40) chain B
residue 114
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

41) chain B
residue 109-110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

42) chain B
residue 113-114
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

43) chain B
residue 117
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

44) chain B
residue 26-27
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence IN
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

45) chain B
residue 32
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

46) chain B
residue 35-36
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence GV
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

47) chain B
residue 38-39
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

48) chain B
residue 42
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

49) chain B
residue 63
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

50) chain B
residue 66
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

51) chain B
residue 40
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

52) chain B
residue 44
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

53) chain B
residue 47-49
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WLD
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

54) chain B
residue 119-120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence HF
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

55) chain B
residue 46
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

56) chain B
residue 50
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

57) chain B
residue 52
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

58) chain B
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

59) chain B
residue 59
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122


Display surface

Download
Links