eF-site ID 3ze3-ABCDEF
PDB Code 3ze3
Chain A, B, C, D, E, F

click to enlarge
Title Crystal structure of the integral membrane diacylglycerol kinase - delta7
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence A:  GFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLCVVIA
AWLDVDAVTRVLLISSVMLVMIVELLNSAIEAVVDRIGSE
YHELSGRAKDLGSAAVLIAIIDAVITWAILLWSHFG
B:  AWINEAAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVM
LVMIVELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLI
AIIDAVITWAILLWSHFG
C:  RQEGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELL
NSAIEAVVDRIGSEYHELSGRAKDLGSAAVLIAIIDAVIT
WAILLWSHFG
D:  AGYSWKGLRAAWINEAAFRQEGVAVLLCVVIAAWLDVDAV
TRVLLISSVMLVMIVELLNSAIEAVVDRIGSEYHELSGRA
KDLGSAAVLIAIIDAVITWAILLWSHFG
E:  VAVLLCVVIAAVDAVTRVLLISSVMLVMIVELLNSAIEAV
VDRIGSEYHELSGRAKDLGSAAVLIAIIDAVITWAILLWS
HFG
F:  EGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELLNS
AIEAVVDRIGSEYHELSGRAKDLGSAAVLIAIIDAVITWA
ILLWSHFG
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)


Functional site

1) chain D
residue 64
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

2) chain D
residue 107
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

3) chain F
residue 60
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

4) chain F
residue 64
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NA F 1122
source : AC1

5) chain D
residue 60
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NA E 1122
source : AC2

6) chain E
residue 61
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NA E 1122
source : AC2

7) chain E
residue 111
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NA E 1122
source : AC2

8) chain D
residue 28
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1122
source : AC3

9) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN D 1122
source : AC3

10) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FLC D 1123
source : AC4

11) chain D
residue 28
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

12) chain D
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

13) chain D
residue 72
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

14) chain D
residue 73
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

15) chain D
residue 76
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ACT D 1124
source : AC5

16) chain A
residue 13
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

17) chain A
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

18) chain A
residue 17
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

19) chain B
residue 98
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

20) chain B
residue 101
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

21) chain B
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

22) chain B
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

23) chain B
residue 110
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

24) chain A
residue 9
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

25) chain B
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

26) chain B
residue 65
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

27) chain B
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

28) chain B
residue 108
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

29) chain B
residue 112
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

30) chain B
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

31) chain A
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

32) chain A
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

33) chain C
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

34) chain D
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

35) chain D
residue 29
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

36) chain D
residue 32
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

37) chain D
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

38) chain D
residue 36
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

39) chain B
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

40) chain B
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

41) chain C
residue 110
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

42) chain C
residue 114
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

43) chain C
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

44) chain C
residue 118
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

45) chain D
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78N C 1122
source : AC9

46) chain A
residue 18
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

47) chain A
residue 22
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

48) chain A
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

49) chain A
residue 26
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

50) chain A
residue 39
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

51) chain A
residue 63
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

52) chain A
residue 66
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

53) chain A
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

54) chain A
residue 31
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

55) chain A
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

56) chain A
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

57) chain A
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

58) chain A
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

59) chain D
residue 22
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

60) chain D
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

61) chain B
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

62) chain D
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

63) chain D
residue 109
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

64) chain D
residue 113
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1127
source : BC3

65) chain A
residue 40
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

66) chain A
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

67) chain C
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

68) chain C
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

69) chain C
residue 112
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

70) chain A
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

71) chain B
residue 35
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

72) chain B
residue 36
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

73) chain D
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

74) chain D
residue 48
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

75) chain D
residue 49
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

76) chain D
residue 120
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

77) chain A
residue 42
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

78) chain A
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

79) chain A
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

80) chain A
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

81) chain A
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

82) chain A
residue 52
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

83) chain A
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

84) chain B
residue 114
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

85) chain B
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

86) chain A
residue 110
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

87) chain A
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

88) chain D
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

89) chain D
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

90) chain D
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

91) chain A
residue 41
type
ligand
sequence C
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

92) chain A
residue 120
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

93) chain C
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

94) chain C
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

95) chain D
residue 39
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

96) chain A
residue 9-10
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence RI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

97) chain B
residue 34
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

98) chain B
residue 37-38
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

99) chain B
residue 41
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence C
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

100) chain B
residue 62
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

101) chain B
residue 65
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

102) chain B
residue 69
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

103) chain B
residue 101
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

104) chain B
residue 105
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

105) chain B
residue 108-109
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

106) chain B
residue 112-113
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

107) chain B
residue 116
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

108) chain A
residue 10
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

109) chain A
residue 13-14
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

110) chain A
residue 17
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence S
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

111) chain B
residue 69
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

112) chain B
residue 72
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence N
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

113) chain B
residue 98-99
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence SA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

114) chain B
residue 101-102
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

115) chain B
residue 105-106
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence II
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

116) chain B
residue 109-110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

117) chain A
residue 18
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

118) chain A
residue 21-22
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LR
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

119) chain A
residue 25-26
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

120) chain A
residue 31
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

121) chain A
residue 35
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence G
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

122) chain A
residue 38-39
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

123) chain A
residue 42
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

124) chain A
residue 63
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

125) chain A
residue 66
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

126) chain B
residue 103
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

127) chain B
residue 106
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

128) chain B
residue 110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

129) chain A
residue 37
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

130) chain A
residue 40-41
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LC
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

131) chain A
residue 44
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

132) chain A
residue 48
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

133) chain A
residue 112
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

134) chain A
residue 116
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

135) chain A
residue 120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

136) chain A
residue 39
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

137) chain A
residue 42-43
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

138) chain A
residue 46
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

139) chain A
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

140) chain A
residue 59
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

141) chain B
residue 110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

142) chain B
residue 114
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

143) chain A
residue 50-52
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VDA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

144) chain A
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

145) chain B
residue 109-110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

146) chain B
residue 113-114
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

147) chain B
residue 117
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

148) chain A
residue 110
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1125

149) chain A
residue 117
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1125

150) chain B
residue 26-27
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence IN
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

151) chain B
residue 32
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

152) chain B
residue 35-36
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence GV
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

153) chain B
residue 38-39
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

154) chain B
residue 42
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

155) chain B
residue 63
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

156) chain B
residue 66
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

157) chain C
residue 103
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

158) chain C
residue 106
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

159) chain C
residue 110
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

160) chain D
residue 40
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

161) chain D
residue 47-49
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WLD
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

162) chain D
residue 120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1128

163) chain B
residue 40
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

164) chain B
residue 44
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

165) chain B
residue 47-49
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WLD
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

166) chain B
residue 119-120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence HF
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

167) chain D
residue 33-34
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence QE
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

168) chain D
residue 98
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence S
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

169) chain D
residue 101-102
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

170) chain D
residue 105-106
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence II
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

171) chain D
residue 109-110
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

172) chain D
residue 113-114
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1127

173) chain B
residue 46
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

174) chain B
residue 50
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

175) chain B
residue 52
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

176) chain B
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

177) chain B
residue 59
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

178) chain C
residue 110
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

179) chain C
residue 113-115
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AIL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

180) chain C
residue 117-118
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WS
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

181) chain D
residue 33
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence Q
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

182) chain D
residue 36-37
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

183) chain D
residue 39-40
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

184) chain D
residue 43
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1122

185) chain C
residue 34
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

186) chain C
residue 37
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

187) chain C
residue 41
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence C
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

188) chain C
residue 44
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

189) chain C
residue 62
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

190) chain C
residue 65-66
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VM
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

191) chain C
residue 69
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence E
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

192) chain C
residue 105
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

193) chain C
residue 108-109
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

194) chain C
residue 112
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

195) chain C
residue 116
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_C_1123

196) chain C
residue 117
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

197) chain D
residue 25
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

198) chain D
residue 29
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

199) chain D
residue 32-33
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence RQ
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

200) chain D
residue 36
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1125

201) chain D
residue 21-22
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LR
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

202) chain D
residue 25-26
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WI
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

203) chain D
residue 31
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

204) chain D
residue 35
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence G
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

205) chain D
residue 38-39
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

206) chain D
residue 63
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

207) chain D
residue 66
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

208) chain E
residue 103
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_D_1126

209) chain D
residue 27-28
type binding
ligand FLC: CITRATE ANION
sequence NE
description CITRATE ANION binding site
source pdb_hetatom : FLC_3ze3_D_1123

210) chain D
residue 76
type binding
ligand FLC: CITRATE ANION
sequence E
description CITRATE ANION binding site
source pdb_hetatom : FLC_3ze3_D_1123

211) chain D
residue 28
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

212) chain D
residue 30
type binding
ligand ACT: ACETATE ION
sequence A
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

213) chain D
residue 69
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

214) chain D
residue 72-73
type binding
ligand ACT: ACETATE ION
sequence NS
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124

215) chain D
residue 76
type binding
ligand ACT: ACETATE ION
sequence E
description ACETATE ION binding site
source pdb_hetatom : ACT_3ze3_D_1124


Display surface

Download
Links