eF-site ID 3ze3-A
PDB Code 3ze3
Chain A

click to enlarge
Title Crystal structure of the integral membrane diacylglycerol kinase - delta7
Classification TRANSFERASE
Compound DIACYLGLYCEROL KINASE
Source (KDGL_ECOLI)
Sequence A:  GFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLCVVIA
AWLDVDAVTRVLLISSVMLVMIVELLNSAIEAVVDRIGSE
YHELSGRAKDLGSAAVLIAIIDAVITWAILLWSHFG
Description (1)  DIACYLGLYCEROL KINASE (E.C.2.7.1.107)


Functional site

1) chain A
residue 13
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

2) chain A
residue 14
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

3) chain A
residue 17
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 78N B 1122
source : AC6

4) chain A
residue 9
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N B 1123
source : AC7

5) chain A
residue 33
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

6) chain A
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1125
source : AC8

7) chain A
residue 18
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

8) chain A
residue 22
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

9) chain A
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

10) chain A
residue 26
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

11) chain A
residue 39
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

12) chain A
residue 63
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

13) chain A
residue 66
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 78N A 1122
source : BC1

14) chain A
residue 30
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

15) chain A
residue 31
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

16) chain A
residue 34
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

17) chain A
residue 69
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

18) chain A
residue 102
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

19) chain A
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78M D 1126
source : BC2

20) chain A
residue 40
type
ligand
sequence L
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

21) chain A
residue 47
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78N C 1123
source : BC4

22) chain A
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M D 1128
source : BC5

23) chain A
residue 42
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

24) chain A
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

25) chain A
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1123
source : BC6

26) chain A
residue 50
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

27) chain A
residue 51
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

28) chain A
residue 52
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

29) chain A
residue 55
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 78N A 1124
source : BC7

30) chain A
residue 110
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

31) chain A
residue 117
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 78M A 1125
source : BC8

32) chain A
residue 41
type
ligand
sequence C
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

33) chain A
residue 120
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 78M A 1126
source : BC9

34) chain A
residue 9-10
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence RI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1123

35) chain A
residue 10
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

36) chain A
residue 13-14
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence AA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

37) chain A
residue 17
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence S
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_B_1122

38) chain A
residue 18
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

39) chain A
residue 21-22
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LR
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

40) chain A
residue 25-26
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence WI
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

41) chain A
residue 31
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

42) chain A
residue 35
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence G
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

43) chain A
residue 38-39
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VL
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

44) chain A
residue 42
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence V
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

45) chain A
residue 63
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

46) chain A
residue 66
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence M
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1122

47) chain A
residue 37
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

48) chain A
residue 40-41
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence LC
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

49) chain A
residue 44
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

50) chain A
residue 48
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

51) chain A
residue 112
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

52) chain A
residue 116
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

53) chain A
residue 120
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence F
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1126

54) chain A
residue 39
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence L
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

55) chain A
residue 42-43
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VV
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

56) chain A
residue 46
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence A
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

57) chain A
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

58) chain A
residue 59
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1123

59) chain A
residue 50-52
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence VDA
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

60) chain A
residue 55
type binding
ligand 78N: (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence R
description (2R)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78N_3ze3_A_1124

61) chain A
residue 110
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence I
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1125

62) chain A
residue 117
type binding
ligand 78M: (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE
sequence W
description (2S)-2,3-DIHYDROXYPROPYL(7Z)-PENTADEC-7-ENOATE binding site
source pdb_hetatom : 78M_3ze3_A_1125


Display surface

Download
Links