eF-site ID 3zdu-A PDB Code 3zdu Chain A click to enlarge Title Crystal structure of the human CDKL3 kinase domain Classification TRANSFERASE Compound CYCLIN-DEPENDENT KINASE-LIKE 3 Source Homo sapiens (Human) (CDKL3_HUMAN) Sequence A:  MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYNKIA MREIKFLKQFHHENLVNLIEVFRQKKKIHLVFEFIDHTVL DELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIK PENILVSQSGITKLCDFGFARTDIYDDEVATRWYRAPELV LKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHK IVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKY PKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFI EKFMPELKAKLLQEAKV Description Functional site 1) chain A residue 10 type sequence V description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 2) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 3) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 4) chain A residue 79 type sequence F description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 5) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 6) chain A residue 81 type sequence F description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 7) chain A residue 82 type sequence I description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 8) chain A residue 83 type sequence D description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 9) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 10) chain A residue 85 type sequence T description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 11) chain A residue 88 type sequence D description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 12) chain A residue 129 type sequence E description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 13) chain A residue 130 type sequence N description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 14) chain A residue 132 type sequence L description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 15) chain A residue 143 type sequence D description BINDING SITE FOR RESIDUE 38R A 350 source : AC1 16) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 17) chain A residue 223 type sequence H description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 18) chain A residue 282 type sequence H description BINDING SITE FOR RESIDUE ZN A 351 source : AC2 19) chain A residue 92 type sequence H description BINDING SITE FOR RESIDUE ZN A 352 source : AC3 20) chain A residue 211 type sequence H description BINDING SITE FOR RESIDUE ZN A 352 source : AC3 21) chain A residue 125 type sequence D description BINDING SITE FOR RESIDUE NA A 353 source : AC4 22) chain A residue 143 type sequence D description BINDING SITE FOR RESIDUE NA A 353 source : AC4 23) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE EDO A 354 source : AC5 24) chain A residue 275 type sequence I description BINDING SITE FOR RESIDUE EDO A 355 source : AC6 25) chain A residue 276 type sequence S description BINDING SITE FOR RESIDUE EDO A 355 source : AC6 26) chain A residue 279 type sequence D description BINDING SITE FOR RESIDUE EDO A 355 source : AC6 27) chain A residue 125 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 33 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 10 type BINDING sequence V description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 30) chain A residue 158 type MOD_RES sequence D description Phosphothreonine => ECO:0000250|UniProtKB:Q9JM01 source Swiss-Prot : SWS_FT_FI3 31) chain A residue 160 type MOD_RES sequence E description Phosphotyrosine => ECO:0000250|UniProtKB:Q9JM01 source Swiss-Prot : SWS_FT_FI4 32) chain A residue 10-33 type prosite sequence VGEGSYGTVMKCKHKNTGQIVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGEGSYGTVMkCkhkntgqi..........VAIK source prosite : PS00107 33) chain A residue 121-133 type prosite sequence IIHRDIKPENILV description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. IiHrDIKpeNILV source prosite : PS00108

Display surface Download Links