eF-site ID 3zdc-AX PDB Code 3zdc Chain A, X click to enlarge Title Structure of E. coli ExoIX in complex with the palindromic 5ov4 DNA oligonucleotide, potassium and calcium Classification HYDROLASE Compound PROTEIN XNI Source Escherichia coli O157:H7 (3ZDC) Sequence A:  AVHLLIVDALNLIRRIHAVQGSPCVETCQHALDQLIMHSQ PTHAVAVFDDESSGWRHQRLPDYKAGRPPMPEELHDEMPA LRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQATI VSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQ QLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGI YENLDAVAEKWRKKLETHKEMAFLCRDIARLQTDLHIDGN LQQLRLV X:  AAAAGCGTACGC Description Functional site 1) chain A residue 171 type sequence L description BINDING SITE FOR RESIDUE K A 1251 source : AC1 2) chain A residue 172 type sequence A description BINDING SITE FOR RESIDUE K A 1251 source : AC1 3) chain A residue 180 type sequence P description BINDING SITE FOR RESIDUE K A 1251 source : AC1 4) chain A residue 182 type sequence V description BINDING SITE FOR RESIDUE K A 1251 source : AC1 5) chain A residue 185 type sequence I description BINDING SITE FOR RESIDUE K A 1251 source : AC1 6) chain X residue 10 type sequence C description BINDING SITE FOR RESIDUE K A 1251 source : AC1 7) chain A residue 127 type sequence D description BINDING SITE FOR RESIDUE CA A 1252 source : AC2 8) chain A residue 172 type sequence A description BINDING SITE FOR RESIDUE CA A 1253 source : AC3 9) chain A residue 185 type sequence I description BINDING SITE FOR RESIDUE CA A 1253 source : AC3 10) chain X residue 10 type sequence C description BINDING SITE FOR RESIDUE CA A 1253 source : AC3 11) chain A residue 35 type sequence Q description BINDING SITE FOR RESIDUE ACT A 1254 source : AC4 12) chain A residue 36 type sequence L description BINDING SITE FOR RESIDUE ACT A 1254 source : AC4 13) chain A residue 141 type sequence R description BINDING SITE FOR RESIDUE ACT A 1254 source : AC4 14) chain A residue 146 type sequence K description BINDING SITE FOR RESIDUE ACT A 1254 source : AC4 15) chain A residue 110 type sequence L description BINDING SITE FOR RESIDUE ACT A 1255 source : AC5 16) chain A residue 113 type sequence K description BINDING SITE FOR RESIDUE ACT A 1255 source : AC5 17) chain A residue 114 type sequence V description BINDING SITE FOR RESIDUE ACT A 1255 source : AC5 18) chain A residue 104 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 171 type BINDING sequence L description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 172 type BINDING sequence A description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 180 type BINDING sequence P description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 182 type BINDING sequence V description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 185 type BINDING sequence I description BINDING => ECO:0000255|HAMAP-Rule:MF_01192 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links