eF-site ID 3zcf-A PDB Code 3zcf Chain A click to enlarge Title Structure of recombinant human cytochrome c Classification ELECTRON TRANSPORT Compound CYTOCHROME C Source null (CYC_HUMAN) Sequence A:  GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKM IFVGIKKKEERADLIAYLKKATNE Description Functional site 1) chain A residue 13 type sequence K description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 2) chain A residue 14 type sequence C description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 3) chain A residue 17 type sequence C description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 4) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 5) chain A residue 28 type sequence T description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 6) chain A residue 29 type sequence G description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 7) chain A residue 30 type sequence P description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 8) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 9) chain A residue 41 type sequence G description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 10) chain A residue 46 type sequence Y description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 11) chain A residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 12) chain A residue 49 type sequence T description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 13) chain A residue 52 type sequence N description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 14) chain A residue 59 type sequence W description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 15) chain A residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 16) chain A residue 68 type sequence L description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 17) chain A residue 78 type sequence T description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 18) chain A residue 79 type sequence K description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 19) chain A residue 80 type sequence M description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 20) chain A residue 81 type sequence I description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 21) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 22) chain A residue 85 type sequence I description BINDING SITE FOR RESIDUE HEC A 105 source : AC1 23) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE HEC D 105 source : AC4 24) chain A residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 25) chain A residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:13933734 source Swiss-Prot : SWS_FT_FI4 26) chain A residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 27) chain A residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P62894 source Swiss-Prot : SWS_FT_FI5 28) chain A residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 29) chain A residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI7 30) chain A residue 17 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 14 type BINDING sequence C description covalent => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 18 type BINDING sequence H description axial binding residue => ECO:0000255|PROSITE-ProRule:PRU00433, ECO:0000269|PubMed:23150584 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI3

Display surface Download Links