eF-site ID 3wxq-A PDB Code 3wxq Chain A click to enlarge Title Serial femtosecond X-ray structure of human fatty acid-binding protein type-3 (FABP3) in complex with stearic acid (C18:0) determined using X-ray free-electron laser at SACLA Classification TRANSPORT PROTEIN Compound Fatty acid-binding protein, heart Source Homo sapiens (Human) (FABPH_HUMAN) Sequence A:  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPT TIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRK VKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH GTAVCTRTYEKEA Description Functional site 1) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE STE A 200 source : AC1 2) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE STE A 200 source : AC1 3) chain A residue 79 type sequence R description BINDING SITE FOR RESIDUE STE A 200 source : AC1 4) chain A residue 116 type sequence L description BINDING SITE FOR RESIDUE STE A 200 source : AC1 5) chain A residue 127 type sequence R description BINDING SITE FOR RESIDUE STE A 200 source : AC1 6) chain A residue 129 type sequence Y description BINDING SITE FOR RESIDUE STE A 200 source : AC1 7) chain A residue 8 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P07483 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 30 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P07483 source Swiss-Prot : SWS_FT_FI3 9) chain A residue 2 type MOD_RES sequence V description N-acetylvaline => ECO:0007744|PubMed:22223895 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 127 type BINDING sequence R description BINDING => ECO:0000269|PubMed:7922029, ECO:0007744|PDB:1HMT source Swiss-Prot : SWS_FT_FI1 11) chain A residue 20 type MOD_RES sequence Y description Phosphotyrosine; by Tyr-kinases => ECO:0000250|UniProtKB:P07483 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 7-24 type prosite sequence GTWKLVDSKNFDDYMKSL description FABP Cytosolic fatty-acid binding proteins signature. GTWkLvdSkNFDdYMKSL source prosite : PS00214 13) chain A residue 23 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P07483 source Swiss-Prot : SWS_FT_FI5 14) chain A residue 83 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P07483 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links