eF-site ID 3wkj-D PDB Code 3wkj Chain D click to enlarge Title The nucleosome containing human TSH2B Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.1 Source (3WKJ) Sequence D:  TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFE RIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSS Description Functional site 1) chain D residue 91 type sequence S description BINDING SITE FOR RESIDUE CL C 201 source : AC2 2) chain D residue 92 type sequence S description BINDING SITE FOR RESIDUE CL C 201 source : AC2 3) chain D residue 35 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000250|UniProtKB:P33778 source Swiss-Prot : SWS_FT_FI15 4) chain D residue 44 type MOD_RES sequence K description N6-lactoyllysine; alternate => ECO:0000269|PubMed:31645732 source Swiss-Prot : SWS_FT_FI2 5) chain D residue 86 type MOD_RES sequence K description N6-lactoyllysine; alternate => ECO:0000269|PubMed:31645732 source Swiss-Prot : SWS_FT_FI2 6) chain D residue 35 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P33778 source Swiss-Prot : SWS_FT_FI4 7) chain D residue 117 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P33778 source Swiss-Prot : SWS_FT_FI4 8) chain D residue 121 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P33778 source Swiss-Prot : SWS_FT_FI4 9) chain D residue 37 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q64475 source Swiss-Prot : SWS_FT_FI5 10) chain D residue 47 type MOD_RES sequence K description N6-methyllysine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI6 11) chain D residue 109 type MOD_RES sequence K description N6-methyllysine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI6 12) chain D residue 58 type MOD_RES sequence K description N6,N6-dimethyllysine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI7 13) chain D residue 80 type MOD_RES sequence R description Dimethylated arginine => ECO:0000269|PubMed:21249133 source Swiss-Prot : SWS_FT_FI8 14) chain D residue 85 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:21249133 source Swiss-Prot : SWS_FT_FI9 15) chain D residue 87 type MOD_RES sequence R description Omega-N-methylarginine => ECO:0000269|PubMed:21249133 source Swiss-Prot : SWS_FT_FI10 16) chain D residue 93 type MOD_RES sequence R description Omega-N-methylarginine => ECO:0000269|PubMed:21249133 source Swiss-Prot : SWS_FT_FI10 17) chain D residue 116 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q00729 source Swiss-Prot : SWS_FT_FI11 18) chain D residue 121 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:16713563 source Swiss-Prot : SWS_FT_FI13 19) chain D residue 93-115 type prosite sequence REIQTAVRLLLPGELAKHAVSEG description HISTONE_H2B Histone H2B signature. REIQTavRlLLpGELaKHAVSEG source prosite : PS00357

Display surface Download Links