eF-site ID 3wge-A PDB Code 3wge Chain A click to enlarge Title Crystal structure of ERp46 Trx2 Classification ISOMERASE Compound Thioredoxin domain-containing protein 5 Source null (TXND5_HUMAN) Sequence A:  GSHMGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAP TWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTL LWFRDGKKVDQYKGKRDLESLREYVESQLQR Description (1)  Thioredoxin domain-containing protein 5 Functional site 1) chain A residue 191 type sequence L description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 2) chain A residue 192 type sequence Y description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 3) chain A residue 193 type sequence E description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 4) chain A residue 229 type sequence Q description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 5) chain A residue 233 type sequence G description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 6) chain A residue 287 type sequence R description BINDING SITE FOR RESIDUE GOL A 301 source : AC1 7) chain A residue 209-227 type prosite sequence FIKFFAPWCGHCKALAPTW description THIOREDOXIN_1 Thioredoxin family active site. FIkFFapWCGHCKaLaptW source prosite : PS00194

Display surface Download Links