eF-site ID 3wg7-Y PDB Code 3wg7 Chain Y click to enlarge Title A 1.9 angstrom radiation damage free X-ray structure of large (420KDa) protein by femtosecond crystallography Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence Y:  HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVR HQLLKK Description Functional site 1) chain Y residue 10 type sequence N description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 2) chain Y residue 11 type sequence I description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 3) chain Y residue 12 type sequence P description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 4) chain Y residue 13 type sequence F description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 5) chain Y residue 20 type sequence R description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 6) chain Y residue 24 type sequence M description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 7) chain Y residue 25 type sequence M description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 8) chain Y residue 28 type sequence F description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 9) chain Y residue 31 type sequence S description BINDING SITE FOR RESIDUE TGL Y 101 source : FC8 10) chain Y residue 9 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P17665 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links