eF-site ID 3wg7-S PDB Code 3wg7 Chain S click to enlarge Title A 1.9 angstrom radiation damage free X-ray structure of large (420KDa) protein by femtosecond crystallography Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence S:  ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATS GTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ RCPSCGTHYKLVPHQLAH Description Functional site 1) chain S residue 1 type sequence A description BINDING SITE FOR RESIDUE PEK P 308 source : FC2 2) chain S residue 60 type sequence C description BINDING SITE FOR RESIDUE ZN S 101 source : FC4 3) chain S residue 62 type sequence C description BINDING SITE FOR RESIDUE ZN S 101 source : FC4 4) chain S residue 82 type sequence C description BINDING SITE FOR RESIDUE ZN S 101 source : FC4 5) chain S residue 85 type sequence C description BINDING SITE FOR RESIDUE ZN S 101 source : FC4 6) chain S residue 37 type TRANSMEM sequence K description Helical => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI2 7) chain S residue 55 type TRANSMEM sequence K description Helical => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI2 8) chain S residue 90 type TRANSMEM sequence K description Helical => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI2 9) chain S residue 60 type TOPO_DOM sequence C description Mitochondrial matrix => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI1 10) chain S residue 62 type TOPO_DOM sequence C description Mitochondrial matrix => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI1 11) chain S residue 82 type TOPO_DOM sequence C description Mitochondrial matrix => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI1 12) chain S residue 85 type TOPO_DOM sequence C description Mitochondrial matrix => ECO:0000269|PubMed:27605664 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links