eF-site ID 3wg7-Q PDB Code 3wg7 Chain Q click to enlarge Title A 1.9 angstrom radiation damage free X-ray structure of large (420KDa) protein by femtosecond crystallography Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence Q:  SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEK EKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVG AAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRM LDMKVAPIQGFSAKWDYDKNEWKK Description Functional site 1) chain Q residue 84 type sequence A description BINDING SITE FOR RESIDUE PGV N 607 source : DC8 2) chain Q residue 87 type sequence F description BINDING SITE FOR RESIDUE PGV N 607 source : DC8 3) chain Q residue 73 type sequence R description BINDING SITE FOR RESIDUE TGL Q 201 source : FC3 4) chain Q residue 77 type sequence E description BINDING SITE FOR RESIDUE TGL Q 201 source : FC3 5) chain Q residue 78 type sequence W description BINDING SITE FOR RESIDUE TGL Q 201 source : FC3 6) chain Q residue 98 type sequence W description BINDING SITE FOR RESIDUE DMU Z 101 source : FC9 7) chain Q residue 7 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P17665 source Swiss-Prot : SWS_FT_FI4 8) chain Q residue 38 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P17665 source Swiss-Prot : SWS_FT_FI4 9) chain Q residue 31 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P13073 source Swiss-Prot : SWS_FT_FI5 10) chain Q residue 34 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P10888 source Swiss-Prot : SWS_FT_FI6 11) chain Q residue 36 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P10888 source Swiss-Prot : SWS_FT_FI6 12) chain Q residue 45 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P19783 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links