eF-site ID 3wg7-L PDB Code 3wg7 Chain L click to enlarge Title A 1.9 angstrom radiation damage free X-ray structure of large (420KDa) protein by femtosecond crystallography Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence L:  HYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVR HQLLKK Description Functional site 1) chain L residue 12 type sequence P description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 2) chain L residue 13 type sequence F description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 3) chain L residue 14 type sequence S description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 4) chain L residue 20 type sequence R description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 5) chain L residue 24 type sequence M description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 6) chain L residue 28 type sequence F description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 7) chain L residue 29 type sequence F description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 8) chain L residue 31 type sequence S description BINDING SITE FOR RESIDUE TGL L 101 source : CC9 9) chain L residue 9 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P17665 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links