eF-site ID 3wg7-D PDB Code 3wg7 Chain D click to enlarge Title A 1.9 angstrom radiation damage free X-ray structure of large (420KDa) protein by femtosecond crystallography Classification OXIDOREDUCTASE Compound Cytochrome c oxidase subunit 1 Source ORGANISM_COMMON: bovine,cow,domestic cattle,domestic cow; ORGANISM_SCIENTIFIC: Bos taurus; Sequence D:  SVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEK EKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVG AAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRM LDMKVAPIQGFSAKWDYDKNEWKK Description Functional site 1) chain D residue 87 type sequence F description BINDING SITE FOR RESIDUE PGV A 608 source : AC8 2) chain D residue 73 type sequence R description BINDING SITE FOR RESIDUE TGL D 201 source : CC3 3) chain D residue 74 type sequence S description BINDING SITE FOR RESIDUE TGL D 201 source : CC3 4) chain D residue 75 type sequence T description BINDING SITE FOR RESIDUE TGL D 201 source : CC3 5) chain D residue 77 type sequence E description BINDING SITE FOR RESIDUE TGL D 201 source : CC3 6) chain D residue 78 type sequence W description BINDING SITE FOR RESIDUE TGL D 201 source : CC3 7) chain D residue 98 type sequence W description BINDING SITE FOR RESIDUE DMU M 101 source : DC1 8) chain D residue 31 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P13073 source Swiss-Prot : SWS_FT_FI5 9) chain D residue 34 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P10888 source Swiss-Prot : SWS_FT_FI6 10) chain D residue 36 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P10888 source Swiss-Prot : SWS_FT_FI6 11) chain D residue 45 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P19783 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links