eF-site ID 3w96-E PDB Code 3w96 Chain E click to enlarge Title Crystal Structure of Human Nucleosome Core Particle lacking H2A N-terminal region Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.1 Source null (3W96) Sequence E:  PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD FKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV TIMPKDIQLARRIRGERA Description Functional site 1) chain E residue 77 type sequence D description BINDING SITE FOR RESIDUE MN E 1001 source : AC2 2) chain E residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:29211711 source Swiss-Prot : SWS_FT_FI21 3) chain E residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:20850016 source Swiss-Prot : SWS_FT_FI22 4) chain E residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI23 5) chain E residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI24 6) chain E residue 115 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI25 7) chain E residue 122 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:27436229 source Swiss-Prot : SWS_FT_FI26 8) chain E residue 56 type MOD_RES sequence K description Phosphoserine; by AMPK => ECO:0000250|UniProtKB:Q64475 source Swiss-Prot : SWS_FT_FI10 9) chain E residue 64 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI12

Display surface Download Links