eF-site ID 3w8j-A PDB Code 3w8j Chain A click to enlarge Title Crystal structure of P5 a0 in a complex with Prx4 c-term Classification OXIDOREDUCTASE/ISOMERASE Compound Protein disulfide-isomerase A6 Source null (PRDX4_MOUSE) Sequence A:  LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHAQ RLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFP TIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRL G Description (1)  Protein disulfide-isomerase A6 (E.C.5.3.4.1), C-terminal peptide from Peroxiredoxin-4 (E.C.1.11.1.15) Functional site 1) chain A residue 21 type sequence Y description BINDING SITE FOR RESIDUE K A 201 source : AC1 2) chain A residue 49 type sequence E description BINDING SITE FOR RESIDUE K A 201 source : AC1 3) chain A residue 58 type sequence A description BINDING SITE FOR RESIDUE K A 201 source : AC1 4) chain A residue 62 type sequence T description BINDING SITE FOR RESIDUE K A 201 source : AC1 5) chain A residue 22 type sequence S description BINDING SITE FOR RESIDUE K A 202 source : AC2 6) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE K A 202 source : AC2 7) chain A residue 27 type sequence V description BINDING SITE FOR RESIDUE K A 202 source : AC2 8) chain A residue 41 type sequence Q description BINDING SITE FOR RESIDUE GOL B 202 source : AC4 9) chain A residue 55 type ACT_SITE sequence C description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 58 type ACT_SITE sequence A description Nucleophile => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 56 type SITE sequence G description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 57 type SITE sequence H description Contributes to redox potential value => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 118 type SITE sequence R description Lowers pKa of C-terminal Cys of first active site => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 129 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links