eF-site ID 3w59-D PDB Code 3w59 Chain D click to enlarge Title Crystal structure of Galectin-1 in the lactose-unbound state(P212121) Classification SUGAR BINDING PROTEIN Compound Galectin-1 Source Homo sapiens (Human) (LEG1_HUMAN) Sequence D:  CGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNL CLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQP GSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMA ADGDFKIKCVAFD Description Functional site 1) chain D residue 83 type sequence S description BINDING SITE FOR RESIDUE GOL A 204 source : AC4 2) chain D residue 84 type sequence V description BINDING SITE FOR RESIDUE GOL A 204 source : AC4 3) chain D residue 54 type sequence D description BINDING SITE FOR RESIDUE GOL C 202 source : AC8 4) chain D residue 92 type sequence D description BINDING SITE FOR RESIDUE SO4 D 201 source : AC9 5) chain D residue 95 type sequence N description BINDING SITE FOR RESIDUE SO4 D 201 source : AC9 6) chain D residue 107 type sequence K description BINDING SITE FOR RESIDUE SO4 D 201 source : AC9 7) chain D residue 107 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P16045 source Swiss-Prot : SWS_FT_FI6 8) chain D residue 29 type MOD_RES sequence S description Phosphoserine; by FAM20C => ECO:0000269|PubMed:26091039 source Swiss-Prot : SWS_FT_FI5 9) chain D residue 12 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P16045 source Swiss-Prot : SWS_FT_FI3 10) chain D residue 127 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P16045 source Swiss-Prot : SWS_FT_FI3 11) chain D residue 28 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 12) chain D residue 44 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 13) chain D residue 52 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain D residue 61 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 15) chain D residue 68 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links