eF-site ID 3vuy-D PDB Code 3vuy Chain D click to enlarge Title Crystal structure of A20 ZF7 in complex with linear tetraubiquitin Classification PROTEIN BINDING/METAL BINDING PROTEIN Compound Polyubiquitin-C Source Homo sapiens (Human) (TNAP3_HUMAN) Sequence D:  PPKQRCRAPACDHFGNAKCNGYCNECFQFKQMY Description Functional site 1) chain D residue 762 type sequence C description BINDING SITE FOR RESIDUE ZN D 801 source : AC1 2) chain D residue 767 type sequence C description BINDING SITE FOR RESIDUE ZN D 801 source : AC1 3) chain D residue 779 type sequence C description BINDING SITE FOR RESIDUE ZN D 801 source : AC1 4) chain D residue 782 type sequence C description BINDING SITE FOR RESIDUE ZN D 801 source : AC1 5) chain D residue 762 type sequence C description BINDING SITE FOR RESIDUE K D 802 source : AC2 6) chain D residue 764 type sequence A description BINDING SITE FOR RESIDUE K D 802 source : AC2 7) chain D residue 767 type sequence C description BINDING SITE FOR RESIDUE K D 802 source : AC2 8) chain D residue 762 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 9) chain D residue 767 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 10) chain D residue 779 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 11) chain D residue 782 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links