eF-site ID 3vux-E PDB Code 3vux Chain E click to enlarge Title Crystal structure of A20 ZF7 in complex with linear ubiquitin, form II Classification PROTEIN BINDING/METAL BINDING PROTEIN Compound Polyubiquitin-C Source Homo sapiens (Human) (TNAP3_HUMAN) Sequence E:  PKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG Description Functional site 1) chain E residue 762 type sequence C description BINDING SITE FOR RESIDUE ZN E 801 source : AC2 2) chain E residue 767 type sequence C description BINDING SITE FOR RESIDUE ZN E 801 source : AC2 3) chain E residue 779 type sequence C description BINDING SITE FOR RESIDUE ZN E 801 source : AC2 4) chain E residue 782 type sequence C description BINDING SITE FOR RESIDUE ZN E 801 source : AC2 5) chain E residue 762 type sequence C description BINDING SITE FOR RESIDUE K E 802 source : AC3 6) chain E residue 764 type sequence A description BINDING SITE FOR RESIDUE K E 802 source : AC3 7) chain E residue 767 type sequence C description BINDING SITE FOR RESIDUE K E 802 source : AC3 8) chain E residue 762 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 9) chain E residue 767 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 10) chain E residue 779 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1 11) chain E residue 782 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00451 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links