eF-site ID 3vhx-G PDB Code 3vhx Chain G click to enlarge Title The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex Classification CELL CYCLE/SIGNALING PROTEIN Compound ADP-ribosylation factor 6 Source Mus musculus (Mouse) (KIF23_HUMAN) Sequence G:  MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS NY Description Functional site 1) chain G residue 22 type sequence D description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 2) chain G residue 23 type sequence A description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 3) chain G residue 25 type sequence G description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 4) chain G residue 26 type sequence K description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 5) chain G residue 27 type sequence T description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 6) chain G residue 28 type sequence T description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 7) chain G residue 41 type sequence T description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 8) chain G residue 44 type sequence T description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 9) chain G residue 66 type sequence G description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 10) chain G residue 122 type sequence N description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 11) chain G residue 123 type sequence K description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 12) chain G residue 125 type sequence D description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 13) chain G residue 126 type sequence L description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 14) chain G residue 155 type sequence C description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 15) chain G residue 156 type sequence A description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 16) chain G residue 157 type sequence T description BINDING SITE FOR RESIDUE GTP G 184 source : AC8 17) chain G residue 27 type sequence T description BINDING SITE FOR RESIDUE MG G 185 source : AC9 18) chain G residue 44 type sequence T description BINDING SITE FOR RESIDUE MG G 185 source : AC9 19) chain G residue 23 type MOD_RES sequence A description Phosphoserine => ECO:0007744|PubMed:17081983 source Swiss-Prot : SWS_FT_FI1 20) chain G residue 63 type MOD_RES sequence D description Phosphoserine => ECO:0007744|PubMed:17081983 source Swiss-Prot : SWS_FT_FI1 21) chain G residue 122 type MOD_RES sequence N description Phosphoserine => ECO:0007744|PubMed:17081983 source Swiss-Prot : SWS_FT_FI1 22) chain G residue 41 type MOD_RES sequence T description Phosphoserine => ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI2 23) chain G residue 155 type MOD_RES sequence C description Phosphoserine => ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links