eF-site ID 3vhx-E
PDB Code 3vhx
Chain E

click to enlarge
Title The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound ADP-ribosylation factor 6
Source Homo sapiens (Human) (KIF23_HUMAN)
Sequence E:  MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET
VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA
DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS
NY
Description (1)  ADP-ribosylation factor 6, Kinesin-like protein KIF23


Functional site

1) chain E
residue 22
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

2) chain E
residue 23
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

3) chain E
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

4) chain E
residue 25
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

5) chain E
residue 26
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

6) chain E
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

7) chain E
residue 28
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

8) chain E
residue 41
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

9) chain E
residue 43
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

10) chain E
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

11) chain E
residue 66
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

12) chain E
residue 67
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

13) chain E
residue 122
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

14) chain E
residue 123
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

15) chain E
residue 125
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

16) chain E
residue 126
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

17) chain E
residue 155
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

18) chain E
residue 156
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP E 184
source : AC5

19) chain E
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG E 185
source : AC6

20) chain E
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG E 185
source : AC6

21) chain E
residue 75
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL F 1
source : AC7

22) chain E
residue 76
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GOL F 1
source : AC7

23) chain E
residue 52-56
type NP_BIND
ligand
sequence VTYKN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI5

24) chain E
residue 111-114
type NP_BIND
ligand
sequence EMRD
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI5

25) chain E
residue 20-28
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GLDAAGKTT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_E_184

26) chain E
residue 41-44
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence TIPT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_E_184

27) chain E
residue 63-67
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence DVGGL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_E_184

28) chain E
residue 122-126
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence NKQDL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_E_184

29) chain E
residue 154-157
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence SCAT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_E_184

30) chain E
residue 75-76
type binding
ligand GOL: GLYCEROL
sequence RH
description GLYCEROL binding site
source pdb_hetatom : GOL_3vhx_F_1


Display surface

Download
Links