eF-site ID 3vhx-ABCD
PDB Code 3vhx
Chain A, B, C, D

click to enlarge
Title The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound ADP-ribosylation factor 6
Source Homo sapiens (Human) (KIF23_HUMAN)
Sequence A:  MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET
VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA
DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS
NY
B:  DQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHV
PHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKG
DIYKTRGGGQSVQFTDIETLKQESPN
C:  MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET
VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA
DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS
NY
D:  DQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHV
PHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKG
DIYKTRGGGQSVQFTDIETLKQESPN
Description (1)  ADP-ribosylation factor 6, Kinesin-like protein KIF23


Functional site

1) chain A
residue 22
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

2) chain A
residue 23
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

3) chain A
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

4) chain A
residue 25
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

5) chain A
residue 26
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

6) chain A
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

7) chain A
residue 28
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

8) chain A
residue 41
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

9) chain A
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

10) chain A
residue 66
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

11) chain A
residue 122
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

12) chain A
residue 123
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

13) chain A
residue 125
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

14) chain A
residue 126
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

15) chain A
residue 155
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

16) chain A
residue 156
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

17) chain A
residue 157
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

18) chain A
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG A 185
source : AC2

19) chain A
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG A 185
source : AC2

20) chain C
residue 22
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

21) chain C
residue 23
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

22) chain C
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

23) chain C
residue 25
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

24) chain C
residue 26
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

25) chain C
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

26) chain C
residue 28
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

27) chain C
residue 41
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

28) chain C
residue 43
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

29) chain C
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

30) chain C
residue 65
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

31) chain C
residue 66
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

32) chain C
residue 122
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

33) chain C
residue 123
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

34) chain C
residue 125
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

35) chain C
residue 126
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

36) chain C
residue 155
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

37) chain C
residue 156
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP C 184
source : AC3

38) chain C
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG C 185
source : AC4

39) chain C
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG C 185
source : AC4

40) chain A
residue 52-56
type NP_BIND
ligand
sequence VTYKN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI1

41) chain A
residue 111-114
type NP_BIND
ligand
sequence EMRD
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI1

42) chain C
residue 52-56
type NP_BIND
ligand
sequence VTYKN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI3

43) chain C
residue 111-114
type NP_BIND
ligand
sequence EMRD
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI3

44) chain A
residue 20-29
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GLDAAGKTTI
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

45) chain A
residue 41-44
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence TIPT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

46) chain A
residue 63-67
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence DVGGL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

47) chain A
residue 122-126
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence NKQDL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

48) chain A
residue 154-157
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence SCAT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

49) chain C
residue 21-28
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence LDAAGKTT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184

50) chain C
residue 41-44
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence TIPT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184

51) chain C
residue 63-67
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence DVGGL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184

52) chain C
residue 122-126
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence NKQDL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184

53) chain C
residue 154-157
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence SCAT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184

54) chain D
residue 695
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence D
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_C_184


Display surface

Download
Links